PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009623355.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 275aa    MW: 30684.7 Da    PI: 8.5437
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009623355.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.46e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv++++ +G g+W++ ++  g+ R++k+c++rw +yl
   XP_009623355.1 14 KGAWTKEEDQRLVNYIRSHGEGCWRSLPKPAGLQRCGKSCRLRWINYL 61
                     79********************************************97 PP

2Myb_DNA-binding591e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEdel+++++ +lG++ W+ Ia +++ gRt++++k++w+++
   XP_009623355.1  67 RGNFTEEEDELIIKLHSLLGNK-WSVIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.741961IPR017930Myb domain
SuperFamilySSF466896.83E-3013108IPR009057Homeodomain-like
SMARTSM007172.0E-111363IPR001005SANT/Myb domain
PfamPF002495.1E-151461IPR001005SANT/Myb domain
CDDcd001671.27E-91661No hitNo description
PROSITE profilePS5129428.49962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2865117IPR009057Homeodomain-like
SMARTSM007177.9E-1866114IPR001005SANT/Myb domain
PfamPF002496.3E-1767111IPR001005SANT/Myb domain
CDDcd001671.12E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLVNYIR SHGEGCWRSL PKPAGLQRCG KSCRLRWINY  60
LRPDLKRGNF TEEEDELIIK LHSLLGNKWS VIAGRLPGRT DNEIKNYWNT HIKRKLISRG  120
LDPQTHRPLS TTTATSTATA TSTSTATKNI CLDMRNTSVA ATPLSLNDQN STNYSYSFEE  180
ETKCSSSTTE ERHEPLEASA AVTEKSSGEV MINLELSIGL PFQAMVAQRR PTVALPVAAT  240
ELVEKAVCLC WQIGSQSGQQ FCGKCQTTNG FYKYC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009623355.10.0PREDICTED: myb-related protein 330-like
SwissprotP813951e-110MYB30_ANTMA; Myb-related protein 330
TrEMBLK4C7D91e-120K4C7D9_SOLLC; Uncharacterized protein
STRINGSolyc06g065100.2.11e-120(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.13e-87myb domain protein 6